PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc02833.1.g00070.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family WRKY
Protein Properties Length: 353aa    MW: 38266.5 Da    PI: 7.5573
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc02833.1.g00070.1.sm.mkhcgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY102.13.3e-32206263259
                                     --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                            WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                     +Dgy+WrKYGqK vk+s++prsYYrCt+++C vkk+vers +dp++v++tYeg+H+h+
  Zpz_sc02833.1.g00070.1.sm.mkhc 206 EDGYRWRKYGQKAVKNSPYPRSYYRCTTPKCGVKKHVERSYQDPSTVITTYEGKHTHH 263
                                     8********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.803.2E-34190265IPR003657WRKY domain
SuperFamilySSF1182909.29E-29198265IPR003657WRKY domain
PROSITE profilePS5081131.984200265IPR003657WRKY domain
SMARTSM007741.8E-37205264IPR003657WRKY domain
PfamPF031064.0E-25206263IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MSSGGVGGGD HHGDYHDQHG RGHLACADGG TDYVFNNHDM ESFFFNQPTA AGAVGGGGGR  60
TGANELMPPY SSITDYLQGF LDPAGLARHL DVPFSADDAP VKNELSVDAS HDSQGTTGVA  120
GSEGAALLAP KWSGSLSSSD REGEGQPGRS RKGRAKQAED AGLVDQRDLE EGENSLKANK  180
PKKKAEKRQR QPRVAFLTKS EVDHLEDGYR WRKYGQKAVK NSPYPRSYYR CTTPKCGVKK  240
HVERSYQDPS TVITTYEGKH THHSPASLRA CGGHLFMPNA HALPPHLMPS GFRPDLMSVM  300
HPMSMGANPN KYFMPSMPPP PVPTSPAPPL HQNHFTDYAL LQDLFPSNMP NNP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A6e-311982661078Probable WRKY transcription factor 4
1wj2_A6e-311982661078Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002455987.11e-166hypothetical protein SORBIDRAFT_03g028530
TrEMBLC5XED41e-166C5XED4_SORBI; Putative uncharacterized protein Sb03g028530
STRINGSb03g028530.11e-166(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62337173
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G29860.12e-43WRKY DNA-binding protein 71